PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.096800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 291aa    MW: 32426.8 Da    PI: 4.5176
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.096800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.77.1e-101452139
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39
                     +grWT+eEd++l++++   G g+W++ ++  g+ R++k+
   Cucsa.096800.1 14 KGRWTEEEDDRLKKYILANGEGSWRSLPKNAGLLRCGKS 52
                     79******************************9999985 PP

2Myb_DNA-binding50.26.1e-165697548
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     T eE++ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
   Cucsa.096800.1 56 TSEEEDVIIKLHASLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 97
                     99****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-11552IPR009057Homeodomain-like
SuperFamilySSF466891.65E-191193IPR009057Homeodomain-like
SMARTSM007174.41349IPR001005SANT/Myb domain
PfamPF002491.5E-71452IPR001005SANT/Myb domain
PROSITE profilePS5129419.64243101IPR017930Myb domain
SMARTSM007175.3E-135199IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-215597IPR009057Homeodomain-like
PfamPF002495.2E-145697IPR001005SANT/Myb domain
CDDcd001671.15E-105697No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRRPCCDKV GLKKGRWTEE EDDRLKKYIL ANGEGSWRSL PKNAGLLRCG KSWNITSEEE  60
DVIIKLHASL GNRWSLIASH LPGRTDNEIK NYWNSHLSRQ IQTFRRRNDD GDSVIVDVAR  120
INLPPRRKGG RGRRRKEESE IPSPLTSEME RESGGCGGCV DEVREEEIIK KTPEGRHDVG  180
GSVTVNLNND VWEEDEMSLD LDELLTSVED YEDEIHKFIT TGTCKSNTDH VSIAPAEMEV  240
GGECSSISSS SLMSLDSPWN WESFAGDIEW DAGEDFGGGV GIAVAESESE A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-15121012105C-Myb DNA-Binding Domain
1mse_C6e-15121012105C-Myb DNA-Binding Domain
1gv2_A6e-15121012105MYB PROTO-ONCOGENE PROTEIN
1h8a_C8e-151210125128MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818741e-85LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132611e-85LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004152356.20.0PREDICTED: myb-related protein P-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.14e-54myb domain protein 111